SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077P388 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077P388
Domain Number 1 Region: 3-154
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000687
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A077P388
Sequence length 174
Comment (tr|A0A077P388|A0A077P388_XENBV) Uncharacterized protein {ECO:0000313|EMBL:CDH05143.1} KW=Complete proteome OX=1398202 OS=Xenorhabdus bovienii str. oregonense. GN=XBO1_1710064 OC=Morganellaceae; Xenorhabdus.
Sequence
MINQTLINYLHSVFPELEIDTSYIRGYTAEEIPKFERLYDIEVKGQLYDFLTCMGRCSGG
LFGDVPLTFYQMQETVRGEVLFQSGQREELCNIQLHHLLDKKPFFISVESYTQYYFLLTT
SDNPDLVYHYDENEETVEATDWTFNEYLRFVVDAYTRNHKVKPPFDLWGELIII
Download sequence
Identical sequences A0A077P388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]