SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077PCH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077PCH2
Domain Number 1 Region: 8-100
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000445
Family SMI1/KNR4-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A077PCH2
Sequence length 126
Comment (tr|A0A077PCH2|A0A077PCH2_XENBV) Uncharacterized protein {ECO:0000313|EMBL:CDH07376.1} KW=Complete proteome OX=1398202 OS=Xenorhabdus bovienii str. oregonense. GN=XBO1_2670004 OC=Morganellaceae; Xenorhabdus.
Sequence
MKKEDVLEKLDLIEEELNIKLPNSYRKFLSEEIQDKPYIEVTGKEQENIYVYNFDYVLER
NKTYTIQEAEPNYFLIGQDGDLGYFIYVEKGKESDVIYSLDLGALGSVDMEEDGDKEADD
IYNLGI
Download sequence
Identical sequences A0A077PCH2 N1NGL4
WP_010846561.1.51459 WP_010846561.1.87433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]