SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077PD43 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077PD43
Domain Number 1 Region: 28-163
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000746
Family SMI1/KNR4-like 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A077PD43
Sequence length 167
Comment (tr|A0A077PD43|A0A077PD43_XENBV) Uncharacterized protein {ECO:0000313|EMBL:CDH22330.1} KW=Complete proteome OX=1398204 OS=Xenorhabdus bovienii str. kraussei Becker Underwood. GN=XBKB1_1080013 OC=Morganellaceae; Xenorhabdus.
Sequence
MKIVDAYNLLNEWLVKSNGELIDLGDGELFSFILKKKFNHTELTTFESNNNILLPDEYKD
FLENVGSVDIFSSDITAGVEVLEPAEIKNFSKEVFEGYGEDLYPNLLLTTSIPKTGYFGG
FWMLEENKNCYSIFYPDVPPEYWIEEAEFSSFNDWIIKLVKSKSKKI
Download sequence
Identical sequences A0A077PD43
WP_038194265.1.63801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]