SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077PDZ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077PDZ7
Domain Number 1 Region: 9-141
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000732
Family SMI1/KNR4-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A077PDZ7
Sequence length 162
Comment (tr|A0A077PDZ7|A0A077PDZ7_XENBV) Uncharacterized protein {ECO:0000313|EMBL:CDH18906.1} KW=Complete proteome OX=1398203 OS=Xenorhabdus bovienii str. kraussei Quebec. GN=XBKQ1_170001 OC=Morganellaceae; Xenorhabdus.
Sequence
MIYYFEFLFSYIKGYSEDEIPKLERLYDIKIKGQLYDFLIYMGRCSGGLFGDDPLNFYQE
QDTVRGEVIFQSCQRQEFAEIQRHDLMAQKPFFISIESHTQFYFLLTKSDNPDLVYCFDE
NEEIVKVTGLTFNEYLRHVVDYDTRNATCKIPFDRSGDLLIL
Download sequence
Identical sequences A0A077PDZ7
WP_038243201.1.88548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]