SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077PQA0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077PQA0
Domain Number 1 Region: 1-157
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000837
Family SMI1/KNR4-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A077PQA0
Sequence length 174
Comment (tr|A0A077PQA0|A0A077PQA0_XENBV) Uncharacterized protein {ECO:0000313|EMBL:CDH26505.1} KW=Complete proteome OX=1398204 OS=Xenorhabdus bovienii str. kraussei Becker Underwood. GN=XBKB1_730003 OC=Morganellaceae; Xenorhabdus.
Sequence
MTKTELIEYLHSAYPELTIDITYIKGYSEEDIVKLERLYDIKIQGQLLNFLIHMGRCSGG
FFSNQPLSFYSETANIRDEIKFQIGCEDGLRELQRFDLVEQKPFFISMENEGILHYFLLT
DSDNPDLVYYLDTNYDTIVDTGLTFNEYLRSVVDSSRGYACKIPLDYTGDLLRI
Download sequence
Identical sequences A0A077PQA0
WP_038193630.1.63801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]