SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077R7M0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077R7M0
Domain Number 1 Region: 4-140
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 2.91e-45
Family Cofilin-like 0.00000432
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A077R7M0
Sequence length 143
Comment (tr|A0A077R7M0|A0A077R7M0_9BASI) Probable COF1-cofilin, actin binding and severing protein {ECO:0000313|EMBL:CDI55188.1} OX=1398559 OS=Melanopsichium pennsylvanicum 4. GN= OC=Ustilaginomycetes; Ustilaginales; Ustilaginaceae; Melanopsichium.
Sequence
MRESQSSGVAVSQECLAQFQELKLGKKIKYIIYTLNSNNTEIVVQNTSTSASYDDFIAEL
PPAECRYAIYDFEYEKGDEGKRNKICFFTWSPDDAKIKQKMVFAASKDALRKALVGISAE
IQGTDFSEVSHETVLEKVSRSTF
Download sequence
Identical sequences A0A077R7M0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]