SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077S7P8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077S7P8
Domain Number 1 Region: 6-75
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000471
Family B3 DNA binding domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A077S7P8
Sequence length 95
Comment (tr|A0A077S7P8|A0A077S7P8_WHEAT) Uncharacterized protein {ECO:0000313|EMBL:CDM86129.1} OX=4565 OS=Triticum aestivum (Wheat). GN=TRAES_3BF042800070CFD_c1 OC=Pooideae; Triticodae; Triticeae; Triticinae; Triticum.
Sequence
MPLDFTKHFVAVPTEFKLRNNTDCSWKVTVKLMNGRLTLDQGWATYVAVHQIKIGYMVTF
KLLTPDTLRVIIFDDDDIEVVNKCGKHDEAFAAKE
Download sequence
Identical sequences A0A077S7P8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]