SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077TIX7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A077TIX7
Domain Number - Region: 194-231
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00126
Family TSP-1 type 1 repeat 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A077TIX7
Sequence length 248
Comment (tr|A0A077TIX7|A0A077TIX7_PLACH) Secreted protein with altered thrombospondin repeat domain, putative {ECO:0000313|EMBL:CDR11008.1} KW=Complete proteome OX=31271 OS=Plasmodium chabaudi chabaudi. GN=PCHAJ_000040400 OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence
MTNHRIVLFFFCFFFLIQKKSNQYNRDYSKINSIDTDEYEDKNKRKRDSYIKPDVGADTC
VIFSAKEGDPHNCWCPRGYIMCSEEDVTDLQTKLEKIEDKNARTKLTPSWVKILCDDSKE
YGFKNMSVVIDYELAVICKDMSNKENPDFEIIGASGYIPNETVINEMKADPTYVPRKCTV
NNFYLCKQVENDNVNCQYSPWSDWTPCIDNKQKRMKKVVRSNQNNTNFCLWNNKKIPRSI
IEQTRSCE
Download sequence
Identical sequences A0A077TIX7 A0A1C6XAM1 Q4XUT7
PCAS_031160 XP_016653201.1.12432 gi|56526679|emb|CAH79324.1| gi|70954189|ref|XP_746153.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]