SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077TLT8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077TLT8
Domain Number 1 Region: 197-274
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.0000000000000157
Family SNARE fusion complex 0.0028
Further Details:      
 
Domain Number 2 Region: 26-129,175-245
Classification Level Classification E-value
Superfamily t-snare proteins 0.0000251
Family t-snare proteins 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A077TLT8
Sequence length 309
Comment (tr|A0A077TLT8|A0A077TLT8_PLACH) SNARE protein, putative {ECO:0000313|EMBL:CDR11618.1} KW=Complete proteome OX=31271 OS=Plasmodium chabaudi chabaudi. GN=PCHAS_061030 OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence
MSYKNHLSGNTTYIEEENVGNNEKKIKDNILLIKKNMIYAEENLENLKNNLISKRIIESL
HEEIHQIYVKVIETENLFRDWEIKFSENPFEKQQKKYIFEKLNIHFKNEVNKLENISLNV
KRAANELPNIENGEMRQSLSNIKKKNSQKMNNSGNNNYYNNSSFISSEFGDDNFILNLDK
TYENNDEFIESSNFYDYELDQFNENDLLIESEIANQRYEGIKKIQGQVAQAQEVFKDLAN
LVFTQRETLDSLNNNIYETNVNTFNSTKELKKTYNNVRQQRISWCLAFITIGIFIYFIYF
KLMHITILG
Download sequence
Identical sequences A0A077TLT8 A0A1C6Y8G4 Q4XS10
XP_745915.1.12432 gi|56526384|emb|CAH80302.1| gi|70953656|ref|XP_745915.1| PCAS_061030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]