SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077W757 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077W757
Domain Number 1 Region: 6-51,162-245
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000000000000615
Family Regulator of G-protein signaling, RGS 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A077W757
Sequence length 362
Comment (tr|A0A077W757|A0A077W757_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:CDS02650.1} OX=688394 OS=Lichtheimia ramosa. GN=LRAMOSA00055 OC=Lichtheimiaceae; Lichtheimia.
Sequence
MASIRNDLPTLEQVLARKTQPPVCLYNLYIIMRDRLHIEEVLDFYLDVQHHQLLWRRYVK
SMRRSGYLTEEDLADGFQSPRVVSRLSQVGSLDEKKATSPLSSTTTLDKQQRGRLQIPGG
RIEEDLQSEDMSVPLERPPLGDDDDDPSNNNNNTVRHAMREKAMLNRRDLTESAQRILMK
YLVPAASKELTQLPPELKHTMRREIEQGGRDDPLVFQDAKDYLFEYMRRTAYPKFLRLKV
WGNLTLWQQLGRLVVGLVSLLAAFATAFSLIFLDYPPWGTRFWILLPFWIGVLNILCFLT
GLDPLWVLLFNVSETTTFHFNRIRQAPVKRILWSRSAWLLALSIIIAVVLTIIFAAVPSH
RL
Download sequence
Identical sequences A0A077W757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]