SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077WJE9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077WJE9
Domain Number 1 Region: 174-301
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.31e-35
Family Eukaryotic type KH-domain (KH-domain type I) 0.00011
Further Details:      
 
Domain Number 2 Region: 80-171
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.57e-25
Family Cold shock DNA-binding domain-like 0.0000751
Further Details:      
 
Domain Number 3 Region: 30-80
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.000000000471
Family ECR1 N-terminal domain-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A077WJE9
Sequence length 304
Comment (tr|A0A077WJE9|A0A077WJE9_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:CDS07269.1} OX=688394 OS=Lichtheimia ramosa. GN=LRAMOSA01218 OC=Lichtheimiaceae; Lichtheimia.
Sequence
MELNILSPVAPVRPKQRANRMEIDDESQPHLVNPGETVTTDQQFMRGHGTYSDGEGVVVS
AVAGAVERVNKLLSVRPLKTRYTPEIGDIVVGRVTEVITKRWKVDVAGRQDAVLLLSSVN
LPGGVQRRKNESDELHMRQFFAEGDVLVAEVQSFYQDGAMGLHTRAFKYCKLRNGSFVSV
PPVLVQRCKSQFHSLPSGVDIILGLNGYIWVNKKMQGIANINSDDIDTSVSYSNENDEIS
MEERESIARVVNCISALAKRYMYINDTVIVYTYEASLPYTVKELLKEDVIETITSEASAR
MQMP
Download sequence
Identical sequences A0A077WJE9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]