SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077WMB0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077WMB0
Domain Number 1 Region: 54-153
Classification Level Classification E-value
Superfamily Cyclin-like 0.0000000000000567
Family Cyclin 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A077WMB0
Sequence length 178
Comment (tr|A0A077WMB0|A0A077WMB0_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:CDS08283.1} OX=688394 OS=Lichtheimia ramosa. GN=LRAMOSA02231 OC=Lichtheimiaceae; Lichtheimia.
Sequence
MATIYQTKSAVHYSSRNSKSASPPPSQLLAQISTNVAKLVECPREARSLAHRRLPSLPNF
IHQVYVKCRMTPTLLTVALIYLQRLQSKLPSGSQGEYDTPYKLYLASVILASKFLEDSHT
VSRDVFRVCAPVYSAQEISVMERSFLGVIKYNLFVKWEEITQFVQDHGEPISILELDL
Download sequence
Identical sequences A0A077WMB0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]