SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077WP02 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077WP02
Domain Number 1 Region: 1-109
Classification Level Classification E-value
Superfamily Signal recognition particle alu RNA binding heterodimer, SRP9/14 1.1e-21
Family Signal recognition particle alu RNA binding heterodimer, SRP9/14 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A077WP02
Sequence length 122
Comment (tr|A0A077WP02|A0A077WP02_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:CDS09105.1} OX=688394 OS=Lichtheimia ramosa. GN=LRAMOSA10465 OC=Lichtheimiaceae; Lichtheimia.
Sequence
MKHMEPNTFTTELAKLYEDSRKTGTGTVSVTMKRMTEDRVNIAKKTMPKEDVAGLTTRLE
LANEQYPCLVRASFKNKKISTVVAGDDLDKFHDAYTTVIKAYMDSLKKKERNKKNKKQKA
AA
Download sequence
Identical sequences A0A077WP02

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]