SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077X4R2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077X4R2
Domain Number 1 Region: 26-55,173-339
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.94e-50
Family G proteins 0.00000669
Further Details:      
 
Domain Number 2 Region: 55-175
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 1.3e-33
Family Transducin (alpha subunit), insertion domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A077X4R2
Sequence length 345
Comment (tr|A0A077X4R2|A0A077X4R2_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:CDS14047.1} OX=688394 OS=Lichtheimia ramosa. GN=LRAMOSA06218 OC=Lichtheimiaceae; Lichtheimia.
Sequence
MGNNHSASKSKAIDKQIKKDQKRLNREVKILLLGAGDSGKSTVLKQMRLIHASGFSAAER
EAFRMVIFGNIVAAMQSLLESMTEMQLTLRNQANWPYISLFENLPILRQGMPYPQEYLQP
LKSLWADEGIQDTFRRGNTFALSDNVQFFYDHIDRVFKPDYSPTDQDIIQCRIKTTGIVE
TTFRNGPIIYRMCDVGGQRSERKKWIHCFENVASVLFVVAVSGYDCCLVEDRDSMYEALM
LFDQICNSQWFTNTSMILFLNKVDIFKKKIRRSPIKHYFPDYSGPSKSYEHAIDYFRKRF
ELLNRNAKKQIYVHYTVATDTQLLGHVMNSVSDSILHENVQTLLL
Download sequence
Identical sequences A0A077X4R2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]