SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077X8N0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077X8N0
Domain Number 1 Region: 56-148
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000336
Family Canonical RBD 0.012
Further Details:      
 
Weak hits

Sequence:  A0A077X8N0
Domain Number - Region: 150-208
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.0745
Family AadK C-terminal domain-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A077X8N0
Sequence length 287
Comment (tr|A0A077X8N0|A0A077X8N0_PLABA) Small subunit rRNA processing protein, putative {ECO:0000313|EMBL:CDS45550.1} KW=Complete proteome OX=5823 OS=Plasmodium berghei (strain Anka). GN=PBANKA_061760 OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence
MDNGSDINSNQKQINKENNKHGKVKKNNTEVVENDRTHEMNELTDERFQFNDSLWKHVKK
EESKKGIIYLSHIPVGLYPSKIREFFSKYGEIDKIHLNKIKNDENNILSKETNHKKIKYK
DGYVEFVNKKDAINVEKLLNNQIISGKKRKNILRDNFWHLKYLKNFTWNDLVSSVLYRNI
SRQEKFKHALKDMYKTYEEYLEKNMSKKKNKKINDKIETTTTKNKYISKKKKTLSTNKSV
KLNFITLKKNDIKDQSQINTNSNNNMEIENKKEKDNIVSSNLLGMFM
Download sequence
Identical sequences A0A077X8N0 A0A0Y9VDE5
PBANKA_061760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]