SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077XA57 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077XA57
Domain Number 1 Region: 717-923
Classification Level Classification E-value
Superfamily vWA-like 2.82e-35
Family Integrin A (or I) domain 0.0025
Further Details:      
 
Domain Number 2 Region: 507-700
Classification Level Classification E-value
Superfamily vWA-like 3.18e-33
Family Integrin A (or I) domain 0.0052
Further Details:      
 
Domain Number 3 Region: 60-254
Classification Level Classification E-value
Superfamily vWA-like 1e-32
Family Integrin A (or I) domain 0.0036
Further Details:      
 
Domain Number 4 Region: 278-472
Classification Level Classification E-value
Superfamily vWA-like 2.64e-31
Family Integrin A (or I) domain 0.0057
Further Details:      
 
Domain Number 5 Region: 943-1135
Classification Level Classification E-value
Superfamily vWA-like 5.79e-23
Family Integrin A (or I) domain 0.0091
Further Details:      
 
Domain Number 6 Region: 1180-1370
Classification Level Classification E-value
Superfamily vWA-like 1.06e-20
Family Integrin A (or I) domain 0.0073
Further Details:      
 
Domain Number 7 Region: 1501-1551
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000275
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Domain Number 8 Region: 1441-1491
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000981
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 9 Region: 1620-1672
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000183
Family TSP-1 type 1 repeat 0.0075
Further Details:      
 
Domain Number 10 Region: 1746-1812
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000301
Family TSP-1 type 1 repeat 0.0058
Further Details:      
 
Weak hits

Sequence:  A0A077XA57
Domain Number - Region: 1374-1436
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0392
Family TSP-1 type 1 repeat 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A077XA57
Sequence length 1905
Comment (tr|A0A077XA57|A0A077XA57_PLABA) Circumsporozoite-and TRAP-related protein {ECO:0000313|EMBL:CDS45067.1} KW=Complete proteome OX=5823 OS=Plasmodium berghei (strain Anka). GN=PBANKA_041290 OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence
MNKKFVLALSYLVLCVHFIIASTKGNQDEFNGGKVVRDSFLQKNISRRQSSPCAGDECFC
QSYYDLTLILDESGSIRKSNWVEYVVPFTEQIVKGLKIGENDIHVGILLFALRNRDYITF
DNDIRYKKTELLKKVNDLNDDYRAGGDTYILEALKYSLKKYSMNKNARDDAPKVTILFTD
GNDIHASKSEFHKMYSEYQEKHVKLLVLGVSAAEESKLKVIAGCENHSSCPSAMKAEWET
INNITNKLTNKICDTESESNIIPEPSQPIPCNGDDCFCKDYYDLTLILDDSVSITLYKWK
KDVIPFSEKLINNLNISKDKVHVGIMRFSKEVITDVDYSQDTRYIKNDLISVVKGLNKKY
RYGSRTNIVDALDYSLKNFTRHPNSRQNAPKVTILFTDGNDTSKTLAEERNMGILYRHEQ
VRLILVGVGQASSIDLYALADCEYGKNCSQVIECKWNELTGITTIITDKICDIESGEIPN
PPETPGSSVVTNPDNVASCQNDEDCYCKDFYDVTLILDESSSIGEFRWTMEVIPFAKDVI
NNLNIDYDSVHVGVLLFSHYALDLVPFSDEARYNKYTLIKKIDSLKTNYGNGHESFIVKT
LKYALSNYTKGSGRTNAPKITMLFTDGNDSSESDIDMYNIGSLYRTERVKLLVIGVSMAS
ENKLKQLVGCAQNLPCPFVIKTEWGTLDALSKVFVDKICDTGSILPPESNKPEPEAPTPP
CIGNDCFCHDIYDLTVILDESGSIGAYNWEKQVYPFTEKFLNNLEISENKVHVGIMLFAQ
FNRDFVKFSDKESYDKENLMKQIKGLKESYKSGGYTYIIEALNYGLANYTHHEASRSDVP
KVTMLFTDGNNTNPGDKLLSDVSLLYKQENVKLLVVGVGASTMANLRLLAGCHKTDGNCP
LATKTEWDNLQDISKLMADKICNAETPEIEEPESTCLGDECLCEDYFDLTFVAVPSSSKD
YKKRSGLIRYAKNIINMFNIGKKNVHVSISIYLGTKSINRDFDDAIAYDRTGLLRVLDQM
DNYFSEDKTNISEALEIGLNQTFGNGNREKAPKIALLLTDSNNDTYEKSRLENISKNYTD
KGVKLLVIGKVDLSKEILFVAGGCDINNDTCSNVLIYNSFINDNSIENFIGENICDNSSV
SGNGNGSGESGGSPLPPSIQCTDELCEECDDDVCDNNPSCKKAMDIVIALDQSRGITNLQ
WTTYVKPFMVYTVKENYLSKNRSHVTIVKMKANRGKEQWSLYRKLSYKKNRILKKIDKLQ
MSYSNIINLADNLKYIRTKTFNKTPAYKKKLIIMLVEGKSNSDLNELRKEIELLKLNKIT
LYVYAIDNIDEKEYKILGDCEISSSICENIVKVSWENLLSSVEIHNKFICNKYPEDAECS
EWGEWSACPQLSCDRAISKRERKRPYYTIKEEGYSGTEYGNSCMDLGSIEYRACPVKDEC
NDVCGDFGEWSQCSTSCGDGIRIRTRNVSPDNEMCQTFNKTEIEPCNIQSCGSTEICEDI
GNWSEWSACSKTCGYSIRERKFTIFPESIDEHSYCEHFEKIETEVCSVPKCENEECFDWD
DWSEWSAPCGPRKRVQRARLYKNRSESSSTIPRPNSGKNDNCEDFYQDKIEYDEESSCPD
NSCGSWTEWSECDRPCNVGMRIRHFITNIVGFNEGNDDECLENYNKIETEPCLNLPICNS
GECNDWETWVDCKTDKDAYTCHVPNKRILTRKLDLLKNPKTDTSQACNDYSLFREEDCPT
GNTPCVDALCNEWDEWGSCSETCGLDSFRIRKRKEPLELIPASSDINGNIGLTCEEQNIR
IEEKEACNVPACVPPVLDGSNNGENSEGDSSEGFGTGEKISMAAGIIGLVGLAAGGLIYG
YNTLNGGETPHNSNMEFENVENNDGIIEEENEDFEVIDANDPMWN
Download sequence
Identical sequences A0A077XA57 A0A1C6WS08
PBANKA_041290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]