SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077XCU9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A077XCU9
Domain Number - Region: 107-150
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.00863
Family NusA extra C-terminal domains 0.049
Further Details:      
 
Domain Number - Region: 49-81
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0314
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A077XCU9
Sequence length 245
Comment (tr|A0A077XCU9|A0A077XCU9_PLABA) Uncharacterized protein {ECO:0000313|EMBL:CDS48206.1} KW=Complete proteome OX=5823 OS=Plasmodium berghei (strain Anka). GN=PBANKA_110990 OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence
MPKILSESHESISNKSDIQLKTEDGSPSNRKGGLVSNKIVSKDAYNNRSSVQQLLARISQ
EIDENKPSDVIHFIVDFLCKHYPEHLHGFEAVWNGDPDLEKERILVVDFFKYQKLPVDIS
VHFINAGFDTIETLCTLSTNSLDDVEKFNNTRWLPGHKVRLQQTFNDITTRVKNFKEERD
SLIKSINQRFISPPHLLNSIMIPKRINPIILPTIPHISSPIQVPNRTSNYTNIDKRFHAP
IIFKR
Download sequence
Identical sequences A0A077XCU9 A0A0Y9XMV2 Q4Z470
XP_674905.1.11252 gi|68065842|ref|XP_674905.1| PBANKA_110990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]