SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077XG80 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077XG80
Domain Number 1 Region: 16-57
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000000942
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A077XG80
Sequence length 59
Comment (tr|A0A077XG80|A0A077XG80_PLABA) Uncharacterized protein {ECO:0000313|EMBL:CDS46909.1} KW=Complete proteome OX=5823 OS=Plasmodium berghei (strain Anka). GN=PBANKA_094300 OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence
MEENSFEFKKVEKINLNSYEIPKYFEEILSEFIAKLLQCHPDNVYKFAFNYFEQKSKNL
Download sequence
Identical sequences A0A077XG80 A0A113RQS1 Q4YYC4
XP_678725.1.11252 gi|68073621|ref|XP_678725.1| PBANKA_094300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]