SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077XHD7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A077XHD7
Domain Number - Region: 4-61
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.0698
Family Poly(A) polymerase, PAP, middle domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A077XHD7
Sequence length 114
Comment (tr|A0A077XHD7|A0A077XHD7_PLABA) Uncharacterized protein {ECO:0000313|EMBL:CDS48104.1} KW=Complete proteome OX=5823 OS=Plasmodium berghei (strain Anka). GN=PBANKA_110600 OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence
MYKLKSFFLRFFLFFVINKYILCKNVNSIRKVSPFIFVQTKLKELNIATPPYTVFNFATE
AISTQDIIEDHLNNKEKKAMRRFKQDLRNKRERSENILANLLLSSLHFFDWEEN
Download sequence
Identical sequences A0A077XHD7 A0A0Y9XKX1
PBANKA_110600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]