SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077XJE2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077XJE2
Domain Number 1 Region: 1114-1154
Classification Level Classification E-value
Superfamily RING/U-box 0.0000177
Family Zf-UBP 0.016
Further Details:      
 
Domain Number 2 Region: 787-823
Classification Level Classification E-value
Superfamily RING/U-box 0.0000389
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Weak hits

Sequence:  A0A077XJE2
Domain Number - Region: 1214-1323
Classification Level Classification E-value
Superfamily Sec2 N-terminal region 0.00392
Family Sec2 N-terminal region 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A077XJE2
Sequence length 1358
Comment (tr|A0A077XJE2|A0A077XJE2_PLABA) Uncharacterized protein {ECO:0000313|EMBL:CDS49603.1} KW=Complete proteome OX=5823 OS=Plasmodium berghei (strain Anka). GN=PBANKA_123590 OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence
MNKNKKKEKLKRKKKHTNSNLNLCKEINDGFSKHSDKSPNNKKEICNHNNTNKLKINNND
SSKKEIISNTSNHYTPENPQCVNKEGKQCGKENSDKEQNGEHSGEQCCQSGKSLEPKTND
ELNMSQNDTSKIRKNNFEINSDWVTGKDKGNQHDDISTPVLKKIENTKGESGIEEIKKND
NSKVNKDEIYNLLNLNNMEEIEKNINYIFPSIDFDNNKSEGIVNVKNDDKKFEEEINKEI
NKFQKDIKDVYFHHNLKKGMKKNKCVNYEKNRNQLNSTCDISLKNIFLENEFVNFSEILI
KGNIFLNLKKKIIKKKKKRKKKKSKTKLKTQNYKLIKELCLFDDAYTKETTQTQRKNEKR
VSKYYIFEYSCGNTKIQSITGCIICYKNYEFYKNNNIKCLKKNIKIYENDRNNINISKIS
QKEENIFEKDKYKNHNFNKNKIMNINLVNEKNISVLLCVNVSNCISPSAFLELLYPCDNF
IFFLKVLNKKCYEEYMIYFLTFSIYTKKILNKAKKIYFFNMKKKKKFKIYIVKGITMNVT
SCITRNNNSNSYINTKKFYNIDLEKKIMCANNNNHIENIQLISNTNFINPFYLISQNKFQ
LSCAVCLEPLYSENLNKIISHIFNFSFQKKYASKIKCNKENYILNNINSEFNASTKIKKV
KTNSCNNFIREEKLSIDIKIENSKVKKNNISDYNNKINIISSISPNTNTPYNNIFLECYK
TNDKHSKEENKIQTYPSNYYYNNLNTLNNYNLNEYAYYLSVTNLINNMQNKYNSQMKRER
KQNDKAKIFNNVPINILCSHIFHSNCLKKCCFTSCPICRYKQYNYEIANCDICKKNYNSK
ICLSCGFIGCSFNYDKIVKIKKKKIKEKKQLLKKKKIIIKKISYIFRKIIKSFMPIFNTI
ILSLYYKSKIKCVYKIRTNQICIYKRKKNKYLSTNYNNKQTNYITYYSDSHNKNKKIFNH
KYSTPQNNNCTQNEKTPNDTLLVFSNNDNIYMNNLNKFSKYIYIGKLANKKKNVSYYFSQ
SINKCIIKKDSKKKNDFINSKEKKTVNKCKLQNKFFNTNIIQANNKKETRKEMNKSGKDY
MHMNKICALENNCSIVAVEKYRKYPLKKKKKKINDHAKTHFYETQHNYFFDVKKNSVYDY
SSDIYIKKLINLKIQNKKLKNIYNTGNIYTNGNSTNQNEEIINKKNIILYIYDFNQLLNA
LLESQRNSFLSCIHDLKINYENINMDNLNDINKCVKEIYILQEKNNNLKNEIKKKINVLI
DKIKTNSDLSRELKNVETINAKLCADQRKQIYNYDLKNEQKKNIIKEKQQIIKELNKQIT
DLNFHKLVSSKFSQNSEITNSFFMIGEKITNKTRFKKR
Download sequence
Identical sequences A0A077XJE2 A0A0Y9YS41
PBANKA_123590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]