SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077XK87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077XK87
Domain Number 1 Region: 240-287
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000379
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A077XK87
Sequence length 348
Comment (tr|A0A077XK87|A0A077XK87_PLABA) Thrombospondin-related apical membrane protein {ECO:0000313|EMBL:CDS51969.1} KW=Complete proteome OX=5823 OS=Plasmodium berghei (strain Anka). GN=PBANKA_143360 OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence
MIKMGRFSIILISFFLTLHQEILGKIDTKKNEDPVVQLLQATQNYKVVVLEPECFINSKT
PKLMNSSNYKDEENFDRKEFLMYNYIVINNYEFSNAKSLEIYSSKEKNITNYLILTFYIE
GLSFLVNKNFIYDIFLHLSTAGDNKKMECTNKYYDVSLLKSIDVLSPSELEILSDPIKFT
MGTESGSFRINITQMFMNDTWKAFIKNKISFLIKPEEDCYVLLEDKLNKPTLVIEKMSSF
YTEWGEWSQCTMECNHPDNVQIRERRCIHPNGDCFKGDLKESRPCNVPLPPCYSLFENKD
SSKLKITIVAFPIIIVICVFIILYRIFYSKKSTEKELYENVAGRFMYE
Download sequence
Identical sequences A0A077XK87 Q95W37
PBANKA_143360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]