SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077XPR1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077XPR1
Domain Number 1 Region: 30-155
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000209
Family SMI1/KNR4-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A077XPR1
Sequence length 163
Comment (tr|A0A077XPR1|A0A077XPR1_9SPHI) Uncharacterized protein {ECO:0000313|EMBL:CDS93135.1} OX=403776 OS=Sphingobacterium sp. PM2-P1-29. GN=BN1088_1431337 OC=Sphingobacteriaceae; Sphingobacterium.
Sequence
MNLLSQHLQFITKKSDHETLNKRFQTRYSYLPDDYLAFLKTYSLLTNQSDTTWFNSIADF
NETNDENDFKWNEFEIQSLDAFDGDVEIEQEVKNFWNKHIPIILSVKKGYSYFAINVSEE
NFGKIYYGDEPEFEEAVLVSNSFTSFIEAIQNKSLKKEYLDLF
Download sequence
Identical sequences A0A077XPR1
WP_045753421.1.70333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]