SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077XRS9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077XRS9
Domain Number 1 Region: 167-307
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 6.75e-41
Family AadK C-terminal domain-like 0.0001
Further Details:      
 
Domain Number 2 Region: 24-159
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 3.6e-27
Family AadK N-terminal domain-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A077XRS9
Sequence length 310
Comment (tr|A0A077XRS9|A0A077XRS9_9SPHI) Streptomycin aminoglycoside 6-adenyltransferase {ECO:0000313|EMBL:CDS93363.1} OX=403776 OS=Sphingobacterium sp. PM2-P1-29. GN=BN1088_100005 OC=Sphingobacteriaceae; Sphingobacterium.
Sequence
MLKVGSIANLPNVVRHSKTEPNKMKVREEKLRTIIEWSEKNEDVRVLLLTSSLVNPLALV
DEFSDLDIEFVFEDNTNYISDKSWTLKFGNPIAMIEEDESCFNHKHAMKMLLYEDGVKVD
FKLYSKSKFIKETQEKELPEDWDIGYKILIDKDGITKQMLKPTYQISIIKKPSEKEFQNL
INDFWWDTTYVAKCLVRDEIFYAKFMSETVIRTEYLIPLIEWHIASEHNWNITTNKYGRL
FKKYLNQEMWAKTEQTFSGSDIKENWTALFSMTDLVSEIGTELSKKLEYKYPDKLENDIR
KYLAGLKPKT
Download sequence
Identical sequences A0A077XRS9 A0A127SVB4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]