SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077Y1T8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077Y1T8
Domain Number 1 Region: 55-143
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000296
Family Canonical RBD 0.012
Further Details:      
 
Weak hits

Sequence:  A0A077Y1T8
Domain Number - Region: 145-204
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.0738
Family AadK C-terminal domain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A077Y1T8
Sequence length 294
Comment (tr|A0A077Y1T8|A0A077Y1T8_9APIC) Small subunit rRNA processing protein, putative {ECO:0000313|EMBL:CDU17054.1} KW=Complete proteome OX=5861 OS=Plasmodium yoelii. GN=PY17X_0620300 OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence
MDDNDVDSNQKQINKENDSNGKVENDNEIVENDRMNEQIDERFLFNDSLWKHAKKEESKK
GIIYLSHIPIGLYPSKIREFFSKYGEIDKIHLNKIKNDENNILSKETNHKKVKYKDGYVE
FVNKKDAINVEKLLNNQIISGKKRKNILRDSFWHLKYLKNFTWNDLVSSVLYRNISRQEK
FKHALKDMYKNYEEYLEKNMDKKINDKINDKINGKISGKIEATTKNKHISKKKKKLTTNK
SPKLNFITLKKNDIKKNDIKKQPQINTNSNNNGEIKNKKEKDNIVSSNLLGMFM
Download sequence
Identical sequences A0A077Y1T8 Q7RSM2
93.m00048|PY00333|PY00333|hypothetical gi|83317661|ref|XP_731259.1| XP_731259.1.76580 73239.Q7RSM2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]