SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077YYY8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077YYY8
Domain Number 1 Region: 101-297
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.27e-50
Family Astacin 0.00066
Further Details:      
 
Domain Number 2 Region: 340-456
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-20
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 3 Region: 458-509
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000196
Family TSP-1 type 1 repeat 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A077YYY8
Sequence length 561
Comment (tr|A0A077YYY8|A0A077YYY8_TRITR) Metalloendopeptidase {ECO:0000256|RuleBase:RU361183} KW=Complete proteome; Reference proteome OX=36087 OS=Trichuris trichiura (Whipworm) (Trichocephalus trichiurus). GN=TTRE_0000153601 OC=Trichinellida; Trichuridae; Trichuris.
Sequence
MANHRAWRLDCIIDNAVNELKQEEKFVAQIKGEERLKDHTKVLLESQEYLKHKPAKQKPG
HFLDSDPDGRSDIVLTAEQAEAIYSTTLHDTGRRKKRKFIALTSRHWNASMPIDYSFDGS
HTEKQERLIELALKHWENVTCLRFRRRYDMPRGNRIIFTDVDGCASNVGRNPMQEPQYVS
LSLDCMKLGVIAHEVAHALGFWHEQSRPDRDQYVNVVWRNIDEGSLAQFLKEQSREVDSK
GIPYDYGSIMHYRSKAFAKNGDLYTLLTSVQNYQRTIGQRDHLSFNDIRLMNEIYCSHVC
PPLKCQRGGYTDPKRCSRCRCPDGFTGKLCDQVMPGFDANCGGLVRVNSRWVYFNSPNYP
KAFKAGQECSWLFKAPPGLRVELEFIERFDIYCKAEHSLCMDYIEVRNSSDFANTGMRLC
CHNIPRQKIYSSTTDMLVLFRSFYRAGLGFRARARAVPPTGEWNQWGTWSSCSVSCGGCG
VQTRQRDCPQGSLCAGEAVETNTCGQQPCDKCKEERMVSISCGLWGLFRCEGMQAVEVPC
KDKCCPGWTVKNGMCHPAIML
Download sequence
Identical sequences A0A077YYY8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]