SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077Z213 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077Z213
Domain Number 1 Region: 34-239
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.78e-51
Family Reprolysin-like 0.0018
Further Details:      
 
Domain Number 2 Region: 351-407
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000051
Family TSP-1 type 1 repeat 0.00027
Further Details:      
 
Domain Number 3 Region: 1287-1347
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000275
Family TSP-1 type 1 repeat 0.0049
Further Details:      
 
Domain Number 4 Region: 819-879
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000419
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 5 Region: 992-1048
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000549
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 6 Region: 762-824
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000124
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 7 Region: 934-993
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000262
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 8 Region: 1046-1102
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000107
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 9 Region: 1403-1464
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000124
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 10 Region: 1353-1408
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000144
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 
Domain Number 11 Region: 1522-1567
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000249
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 
Domain Number 12 Region: 1166-1217
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000405
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Domain Number 13 Region: 877-930
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000628
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 14 Region: 1463-1522
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000327
Family TSP-1 type 1 repeat 0.0065
Further Details:      
 
Domain Number 15 Region: 1573-1619
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000314
Family TSP-1 type 1 repeat 0.0058
Further Details:      
 
Domain Number 16 Region: 704-763
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000288
Family TSP-1 type 1 repeat 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A077Z213
Sequence length 1892
Comment (tr|A0A077Z213|A0A077Z213_TRITR) A disintegrin and metalloproteinase with {ECO:0000313|EMBL:CDW53728.1} KW=Complete proteome; Reference proteome OX=36087 OS=Trichuris trichiura (Whipworm) (Trichocephalus trichiurus). GN=TTRE_0000199301 OC=Trichinellida; Trichuridae; Trichuris.
Sequence
MQTEKADIDGRANATDNELKNKSAWSNRRKRSYSREYFVELLVVTDTRMRHYHRHNLENY
VLTLLSIVATVFRHPSLEASLSIHLVKLLIVDYENAGPRINDNAQQTLREFCRWQHSIND
PDDESANHHDVAVLLTRHDICRLPGKCDTLGLAELGTMCDPFRSCAIIEDNGLSAAFTIA
HELGHIFNVPHDDEKKCAQYMTLNKDNYHIMAPTLEFNTHPWSWSPCSTAMLSKFLGFKF
ELTLACSSEMAHCMLDKPVEQKYSAMLTANPAPGLSFDANQQCQFVFGPTSSLCPYMPTC
KRLWCTTPYGHGYPSGCRTQHMPWADGTPCGSNRWCYRGDCVGIAPAHMLAVDGAWGEWK
SWSECSRTCGGGVKKATRECDNPRPSNGGKYCVGERVRHRSCNIKDCPIDSVGFRELQCA
EFNGKPVGIYGISSDVRWVPKYNGVNTANRCKLYCRIVGTAAFYLLKDKVVDGTPCGRYT
EDICVDGTCRKAGCDNRLGSDLKRDDCGICGGDGTSCAKVSGAYNEIHVYGYNFVTKLPV
GASNIDIQQVAWNGKKEDDNYLALQNSKGEFILNGHFQVSVYSQEIAVLGSVIEYSGSDS
FIERLNSSRPIMEELFLHVLSVGGLNMPDVRYNYSIPKTPVHSYIAPSEYAWRNTEEWTD
CNRICQGSQDVKTECIEIEEEQVVDDRYCESFKRPDRMTRACNLHCQTRWESTPLSDCSV
ACGSGEQVMQVSCVKFSSEQEKHIVDSSHCDDKEKPPATRQCYKDCAGRRWVYGDWEQCS
VSCGGGIQQRQASCVDSNNNIIDVRYCENVINDIAEQPCNNVPCPAWSYGDWGECSASCD
GGVQVRLAVCTDIAGREVDASFCDSASLLVQQKCNEHMCTQWMYGPWSDCSKTCGDGIST
RDAWCVDSKGTKLDDSNCSEEKKVASQVCRHLSACPQWKLGEWSSCSRTCLDGWKTRRIQ
CVDGNDEELDPKYCTDPKQARPPTHQPCNLGPCPFWRKHDWSACSVTCGSGTQVRTVECV
YKNEVVGTGYCRNLPMPSNHRICDLVLCPEWELGPWEPCSVTCGVGQQKRVVRCIYQDSR
VVAEAGACDEMNKPVTDRQVCVQAVLPSFRDFILKFCIQPDCSLLIYSSVSGPMSLVDGR
NRSSTLRSPMLRTSIVSKAVDSNAPTKWETGPWTECSTNCGEGKRSRLVVCRDVYGRVLP
DVYCGHASPPVGLEKCSSRCGRWQTGPWLPCPESCKKNANTYREVACISVLTNDRTDISD
CDLDRRPVSEKACNLSQCERSTYYGDPLPGYVWRTGDWSSCSRTCGRGIQERLVQCVEEG
TGSLAPRSVCPHYQQPKTHRPCMMQKCLGTSTQWRSGKWSPCSVTCGRGTRSRRVQCVKV
DSGKPLPDEDCSLLDKPPHLHRCRMLTCPRWRVYKWSPCSATCGHGIRSRKVVCLLGRHD
VRPDGDCDLVTKPVTTSKCVDNQCPRYRWATSDWSRCDKHCGEQQQVRETYCIDENEQRV
EPARCDASAKPAAVRKCLSELCPYMWVPGPWSTCSKTCGEGEQFRSFHCVLKGGGLGMGS
EAVVEMCNALPEPCSVTCGWGTQERRIRCVNRHGLRTSKELCNPGLKPKKRRRCLVKDCS
HHPMETAASYQISQIGSLTSLSARNSTGPYVYRWPKNCYELRQMRNTSADGEYTIWARGS
ALRIYCYGMKNLYPKEYLTLQTDPLSNFAEFYGKRLLNSVSCPYDAKRNDSCACTEESNP
PPGLTRFHRINIDLDTLRVNSIVVLTVHDGHFATVEHGSFVPFATAGDCYSAVRCAQGRF
SVNLRGTGFRVSQLTKWVENGHLAYTEVRRNVNSEVVVGVCGGFCGNCFPDKSVGLLLEV
VEPQSRPHTYGSSTAPWWTLLKGGLGHVDRTT
Download sequence
Identical sequences A0A077Z213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]