SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077Z3L6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077Z3L6
Domain Number 1 Region: 645-696
Classification Level Classification E-value
Superfamily BPTI-like 0.0000000000000312
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0033
Further Details:      
 
Domain Number 2 Region: 734-783
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000131
Family TSP-1 type 1 repeat 0.0015
Further Details:      
 
Domain Number 3 Region: 591-643
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000275
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 4 Region: 791-837
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000876
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 
Domain Number 5 Region: 466-515
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000314
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 
Domain Number 6 Region: 530-577
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000419
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A077Z3L6
Sequence length 841
Comment (tr|A0A077Z3L6|A0A077Z3L6_TRITR) Spond N and Reeler and Kunitz BPTI and TSP 1 doma in containing protein {ECO:0000313|EMBL:CDW54248.1} KW=Complete proteome; Reference proteome OX=36087 OS=Trichuris trichiura (Whipworm) (Trichocephalus trichiurus). GN=TTRE_0000251801 OC=Trichinellida; Trichuridae; Trichuris.
Sequence
MLVGKAIAAILLTLCFGCFGKRPDCDRRPLKNSNALKSPGNNGFQVIVKPYPLNGSLDEV
TGYIPGEKYTIVIQGWKTRFTIQTFRGFTLAALSSNDENEPAGLFQLKEDGDIRWSVDCW
HAVTHSSMFPKANVSVIWQAPPHDEGCVTFKAAVLEYPNIWYMDDDELTKKLCIRGIASL
IYYNTHKAGYDSPKNLDATEECCSCDEAKYEVIFDGLWSRQTHPRDYPSLEHLTHFSDII
GASHSRRYIMWAYGGYASDGMKELAEWGSTQAYEQEIREQVGVLIQFAQICIRGAYLQAS
EVRTIIKARGLWYPNVQGITRAMFRVDRYHHLVSLASMLGPSPDWVVGLSSFNLCLKNCS
WIDEKTFYLYPFDAGVDSGITYMSPNNPSIPREPIKAITTKSPADPRSPFYNADSDTLPP
FAKLTFRKDKVYPSECKDSSEYLLASRASTGETETSEDLENKGKKECTVLNWAPWSLCSA
TCGKGIRMRTRGYKNPVKAHIMGCSRQMNEKQFCNALLSVCHGSENFNDQCAASPWAQWT
ECSAKCGQGMRSRVRNYLNPMAIKQCSIQLTENENCTGSAGLECNVVEDPHCQATQWSEW
SPCSRSCDEGIRLRTRLLYRPENQESCKHLELLQKESCNLLSCDTFMRTHAAEICSELME
RGQCEGTFPRYYFDSGTKTCRRFTYTGCKGNRNNFLVRSKTYAYSLVTEVVHEDNDLNAL
RDTTTTRDNGTPKDCVVSGWSDWSECTQTCGRGMKERVRTILSPARNGGQPCPVELVEKA
RCRLRPCSVVCRIGSWSSWSACSASCGTGVQIRQRVAKNPHKQPECPAQQTEKRMCIESN
C
Download sequence
Identical sequences A0A077Z3L6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]