SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077Z459 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077Z459
Domain Number 1 Region: 284-352
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000205
Family Eukaryotic type KH-domain (KH-domain type I) 0.00029
Further Details:      
 
Domain Number 2 Region: 115-187
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000687
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 
Domain Number 3 Region: 18-110
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000646
Family Eukaryotic type KH-domain (KH-domain type I) 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A077Z459
Sequence length 353
Comment (tr|A0A077Z459|A0A077Z459_TRITR) Heterogeneous nuclear ribonucleoprotein K {ECO:0000313|EMBL:CDW54841.1} KW=Complete proteome; Reference proteome OX=36087 OS=Trichuris trichiura (Whipworm) (Trichocephalus trichiurus). GN=TTRE_0000311101 OC=Trichinellida; Trichuridae; Trichuris.
Sequence
MKRFNDNRVGANDAVKRVRDLGNQLLVRLLIPSRAAGAVIGKGGSFIQYLRSEVSRLFLS
ILGSPAASSRKNAVINLPDSDNPERVVYISSNDMLNIVSCVAEIIPKLEEGRYSPESELR
VLIHHSQAGAVIGRAGFKINEIRESTGANIKVFTDCAPMSSDRVVQFSGSRDAIVNALFE
VTKLCQAVYLESCARMDLSIASFLKTPIRGVDQPYDPVNYDLDVVCSYGGFPPDKAWKNR
RPIGGQMLGVRPVPTPFHGVAAAPPFASPIGVYAQPPPTIFAEGPLQTVRVTIPNDLAGS
IIGRRGERINRIRQESRANIVVDPPVAGAVDRVITISGLPSQIRLGHFLLQQW
Download sequence
Identical sequences A0A077Z459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]