SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077Z6W2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077Z6W2
Domain Number 1 Region: 265-397
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.84e-40
Family Regulator of G-protein signaling, RGS 0.0000226
Further Details:      
 
Domain Number 2 Region: 3-118
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000476
Family DEP domain 0.02
Further Details:      
 
Domain Number 3 Region: 208-260
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.00000000981
Family Transducin (heterotrimeric G protein), gamma chain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A077Z6W2
Sequence length 475
Comment (tr|A0A077Z6W2|A0A077Z6W2_TRITR) Regulator of g protein signaling {ECO:0000313|EMBL:CDW55564.1} KW=Complete proteome; Reference proteome OX=36087 OS=Trichuris trichiura (Whipworm) (Trichocephalus trichiurus). GN=TTRE_0000383701 OC=Trichinellida; Trichuridae; Trichuris.
Sequence
MDALCVQMMSPEFGLPVKGQKYFRTYVPASFTGKSLSPCKAMVKSSSLGNELIEWLISNL
LDVDQAEALHLANQLCIFGYVFPVFEATGSIKEDNCLFRLQIPYFWPSHNLQPDNVEYAI
FLSKRLLRNEEKHGLVEHEAESYQRLRELLGHMWDFIQSQAELQLKMFKEKKKADKVVFD
SQEKAYWRIHRPPSKRKVQRTTNASGFEIDRLKQILKVKPWLKSAKSLETLVSWCGQFAN
YDPILTPPRDPANPWLNANKYIQVSFPTERRVRRWGFSIQELIKDPIGRQVLETFLESEF
SQENIKFWQAVQDLKYSPSSEVARKVEAIYNEFLVSGAPCQVNVDSQTLESVNKSMHEKS
IPLRYCFSQAEEHIFILMSKDSYPRFARSEIYKNMLAAAQQQGSKKLGWSSFLFNHGPLK
KGQPTRTSPQSFYKNKEEGSMGRLLTADFQAATKKPTYFPFAVCNNAVNFVLPFA
Download sequence
Identical sequences A0A077Z6W2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]