SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077Z7F7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077Z7F7
Domain Number 1 Region: 139-356
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.05e-29
Family Reprolysin-like 0.003
Further Details:      
 
Domain Number 2 Region: 740-788
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000759
Family TSP-1 type 1 repeat 0.0017
Further Details:      
 
Domain Number 3 Region: 932-981
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000144
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 4 Region: 686-731
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000706
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 5 Region: 788-831
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000811
Family TSP-1 type 1 repeat 0.00097
Further Details:      
 
Domain Number 6 Region: 835-885
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000114
Family TSP-1 type 1 repeat 0.00083
Further Details:      
 
Domain Number 7 Region: 1007-1051
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000732
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 8 Region: 885-927
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000732
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A077Z7F7
Sequence length 1056
Comment (tr|A0A077Z7F7|A0A077Z7F7_TRITR) Protein ADT 2, c {ECO:0000313|EMBL:CDW55578.1} KW=Complete proteome; Reference proteome OX=36087 OS=Trichuris trichiura (Whipworm) (Trichocephalus trichiurus). GN=TTRE_0000385101 OC=Trichinellida; Trichuridae; Trichuris.
Sequence
MFIPDVLVIHRYHNYTPVEIGPKRTNCVHYAVKEADIHGIFSLCGQQWRGTLKVDDDLYT
LQPLPEGLATLDDILTKRRNLVGEPKRHVLYKRSPFMTDSPSFCGVDTSYERTMMDDPTK
IRKMPIGVGGPQSPVVMHSEKLTMEIAIFVDNELWLKYSRKYGAAADEKLTDFMNTVIHH
VQILYQDQSISPQLEFSVVRFEVFKTQPKALKGPKHGHGNALSYLNAFCKYQYYLSTRRR
WDFALLFSGYKKNWMSIYPTTRRICRYDIHRPPSDRTISGIARLYGVCDPLNSCLLAEGT
DFSSVYITTHEIGHGLGMLHDEPYCASNYIMSGSLGAGKVHWSKCSNRSFQTYLKKLNYY
RRNCLISAQFPVGPINTTLLPGQKYSADEQCQMVHGSDYNRVKTSERSTEGICHMLWCGQ
NNWGRIITSHPALEGTTCAAGKYCRGGKCIPDRSKNPPKVVNGAWSSWKRVSCSACSCPP
IISSIGVLKSERTCTNPAPENGGADCSGSSHRAIVCNRNCGLRPHIAEVVSAKLYTSRIC
AGHRQRLKDATINGIGVQLTRFSSRACKVFCEINVTNADSINFRFFGDWMPDGSPCGDNH
YCINGKCLPLDCRDSALVFNPSDCPTESESCQLEPKRPIGRIPALSNSIIDNSGDRETLS
DEDKSRQHGEMLDRVTDLPSNDILPSWSPWSAWSDCSASCGDGIKTRGRTCWRDHCDGDA
IDRDSCRLQPCVEARSIDFKDPLWSSWTEWTPCSTTCGTGARARYRKCIIGNCPGSYNEV
QQCEMPACGHWTSWSAWSDCSATCGVGVRRRSRLCDGSRCPGDQEQTFMCHERACDLSGE
WYSWSAWSPCTVTCGMGERQRSRICKGTKCNGIATMSEQCKQAECAAWAPWEQWSACSRS
AGMRFRSRQCHGLGKCVGHNSDSEHCMIFVNSNGWTEWSAWSDCSRTCGVGLRRRYRTCL
GTREMCPGDFKAFETCQMRDCPQTGPFQHIKPLIIGNGHPQSAANEYSWSQWSHCIGHCG
TGIRKRIRLCRGPNCPANVLSESQYCQLLPCGGPGR
Download sequence
Identical sequences A0A077Z7F7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]