SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077ZE21 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077ZE21
Domain Number 1 Region: 7-62
Classification Level Classification E-value
Superfamily BPTI-like 4.68e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0031
Further Details:      
 
Domain Number 2 Region: 68-122
Classification Level Classification E-value
Superfamily BPTI-like 3.12e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0016
Further Details:      
 
Domain Number 3 Region: 125-178
Classification Level Classification E-value
Superfamily BPTI-like 7.38e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A077ZE21
Sequence length 186
Comment (tr|A0A077ZE21|A0A077ZE21_TRITR) Serine protease inhibitor 2 {ECO:0000313|EMBL:CDW58606.1} KW=Complete proteome; Reference proteome OX=36087 OS=Trichuris trichiura (Whipworm) (Trichocephalus trichiurus). GN=TTRE_0000692901 OC=Trichinellida; Trichuridae; Trichuris.
Sequence
MCLKQGKKDPCKQPMDAGPCMAAVDRWYYNQETKDCQQFTYGGCQGNENNFSKQECEEKC
LDELKSFGICGQPAEAGNCRARHQKWFFKPQTRKCETFYYGGCGGNSNNFDSKQQCETVC
LDELTCNQKMDAGPCRGAFQMWYFNRDGKKCEPFTYGGCEGNSNRFETKAACDKKCNRGV
NVRRKR
Download sequence
Identical sequences A0A077ZE21

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]