SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A078AEA2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A078AEA2
Domain Number 1 Region: 995-1289
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.73e-76
Family Protein kinases, catalytic subunit 0.000000874
Further Details:      
 
Domain Number 2 Region: 500-626,658-680
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.7e-25
Family Nucleotide and nucleoside kinases 0.00027
Further Details:      
 
Domain Number 3 Region: 305-431
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.93e-17
Family Nucleotide and nucleoside kinases 0.00075
Further Details:      
 
Domain Number 4 Region: 104-186
Classification Level Classification E-value
Superfamily Peptidyl-tRNA hydrolase II 0.000000000115
Family Peptidyl-tRNA hydrolase II 0.0017
Further Details:      
 
Domain Number 5 Region: 14-62
Classification Level Classification E-value
Superfamily UBA-like 0.000000734
Family UBA domain 0.026
Further Details:      
 
Domain Number 6 Region: 265-305
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000186
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0056
Further Details:      
 
Domain Number 7 Region: 626-653
Classification Level Classification E-value
Superfamily Microbial and mitochondrial ADK, insert "zinc finger" domain 0.0000977
Family Microbial and mitochondrial ADK, insert "zinc finger" domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A078AEA2
Sequence length 2202
Comment (tr|A0A078AEA2|A0A078AEA2_STYLE) Adenylate kinase family protein {ECO:0000313|EMBL:CDW79832.1} KW=Complete proteome; Reference proteome OX=5949 OS=Stylonychia lemnae (Ciliate). GN=STYLEM_8824 OC=Stylonychia.
Sequence
MESTQKVQEKSGANDFNGEVDMNLVQQLMEFGFGFEEAMLALKISQNDMAQAGELLSSGG
AELETLRILAKSAQIQKDTDQFKDDLDDNQFYPEEVDSPKGKATKMVIVVRQDQGLKNLS
LGKSAQFVSEGVVLAYQRGQEFNKKVVSVWENQAWPKIALKCDDLEELLKIEENAKNAKI
NSFVLRKKIAFPLKSKTQQTGKQVVEEEVKNAVEGGDVKSNVEESKSEEKSEEIKADSEQ
PIEEKEEPILCVVGPGYADEINKVTESYLEDNQVYELFEGLLKQLVINRPDQPLEFLIQK
LSKPEPKRIFMVGPPGSNRKENALALAEYFNWQSISIGDLLKKEVSKKSEYGKAISESLK
NYRYVDDNIVVEIVKNQIKNCEKDGQSWIIEGFPRTKVQALALQKIGVIPDKFILLDVKK
SASITKVKNNLIQNNTVLYGPELEETANQAIEEYELHIKGVKEAFNGFIYEYSAVDKAQN
DVANDLARMLRIRYRSNAPRRPPRVILLGPPGSGRSTQAEVIAKRYGLVHICTRSLLKAE
IARNPSAGKNISHCLDNGLLVPDQIVLPLVEQRLKQSDCRVNGWILDGFPQTDAQINLLK
SLKIRPSLVCLFEQTEDESVRRLSNRRIDPQTGAYYNLEINPPKEEAVAARLIELHEDKE
STVRKRQEIWNTQVSNIEEAFKSMLLNVPSDKPVDQIDRGKSQSPFSGSRSLITSKSPLR
LNEQGGITRNDAIVDGIKGNRMTASHIIGPLTPSNKQLLTKGKLVAMRELQQEQFLKSQN
KNKHMNSILVQTMSPSKKEEKKKVNLVERKSVAQTHYQVNHSVLSNNDDLQSTPQVMQVN
QDIDLLQMQYNQKALSQIYAETIKSSPKRFTFDKTELQEKRTNRKSFEIQRENYSPEEYD
TKVKVFYDQAKYVTIRWSSHNMNLTCGWLISEIMRHLMFEEDFNKRTHIIGIRNIHQKAT
PPEKFLLGSITSANSNFSPIFSETNMGQHTSHVTLEDFEFIKVIGKGGFSKVFQVRKKDT
GKIYAMKTLSKAKIKRDNKVENILNERAILEQVAHPFIIQMKYAFQNFCAGGELFYRLNN
IPQGRMTERQAKFYFAEILMAIQYLHDSQILYRDLKPENIVIDENGHIKLTDFGLSKVGF
KMGDRAYSFCGSPEYMAPEMLLTEKNRQMGLQPLHHDKSLDFYHLGALLHEILVGLPPFF
SEDRQKMYQDIIYAPTTIPSYLSKECQNLLEGLLQKESTKRLGSKRGAVEIREHPWCADI
DWDRILRKEVMPPFKPFQDRSNFDPEYTSMNPILEDEDILVSLDDQSKQKSAGEFLNEYE
NRIAKSKNNKQMQEQMQNQQKLTRQHSIELYERENKTFRGYSFLQDPINPNIINQHTQGG
FQDNDGFYFCLADSKDQSFTLGSPIQELDCLSDGEIVTLYQRPSHINHAQMMHIEQEMMI
MFQNQSKNQQSQQSILSEDTEGMKANINQMSFKKKDIEKNLKVQLQSNYLSKDGQKFIQQ
QQSKESLYNELLSTFDYSVGKKDRVQEQIKKNNNQTLSTMSLFSLSQQNHMGSYLLSQGG
EKYFQQNLSKLMEEKKMQSKSQNKEKLEFQKIVRKYSPEIDLQRALVQSKQKIANDLIQT
IKQQQQQQSANKKSLQISVNNQLNIQHESVQSRANSNNNTKINSQTTQKKTQQLYISEYG
TFGNPKQSKIGNKKRVSETNSNRAGSPSEKILVKQQNGKKQSVSKNHHNSILKQSQNQTM
LLSNNQSQGIQTSLKTSQLYSQVQTKVSSKKSRNQSNQNKDVNNNNQNLNNNNLSNIINK
EEELCDDGEQYVSDQIHQDHQFKIESNYQTLDENHNLQQNPSGKFIVEQITANELLGSFL
AQQSSHSSHHQILMHPNGDQTLIDYVGNSSLGSLGPNERSFEEVSKEAMAAMILNQSNES
CCCSDDEFALKQIGKKSTMMENVSPKGKIYKNPRNLFHNGLQESINANQIKHQANDQQFK
KLLEEQKTLNPFEEEKNPTSKRITLNNQNKFFSDQAITTPIPQDGRQLSQEDKQKVNKST
NASIIDLNLQKNSRSINTSQIIQIKNEKKISTTGLTTRHIGLGSNSNAHKTQSSNQHTLN
MLNKTTPISPLRDSRQPMQNQATKLKERPIINLKYEANIGQNSQQSLTIQTNVINQASSL
SLISSTPRGTATRQSKMLLNNKLSHVNTFNNTHISTTKNLKK
Download sequence
Identical sequences A0A078AEA2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]