SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A078API9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A078API9
Domain Number 1 Region: 50-87
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000392
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A078API9
Sequence length 122
Comment (tr|A0A078API9|A0A078API9_STYLE) Riia domain-containing protein 1 {ECO:0000313|EMBL:CDW83871.1} KW=Complete proteome; Reference proteome OX=5949 OS=Stylonychia lemnae (Ciliate). GN=STYLEM_12923 OC=Stylonychia.
Sequence
MTDREENDRHGGTSDIFTNNHDLIGVEGIIRSQKNEIEKKKLELRIENEKYFRQHPEIRG
LITLFVRKILDDRPDNILEYAGTFFDRAELRDVVEQAIEQERREAERNELLNNLIKGKTL
IQ
Download sequence
Identical sequences A0A078API9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]