SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A078ARM0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A078ARM0
Domain Number 1 Region: 129-326,402-562
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.33e-32
Family Quinoprotein alcohol dehydrogenase-like 0.023
Further Details:      
 
Domain Number 2 Region: 584-614,648-731
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000968
Family Pseudo ankyrin repeat 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A078ARM0
Sequence length 1121
Comment (tr|A0A078ARM0|A0A078ARM0_STYLE) Uncharacterized protein {ECO:0000313|EMBL:CDW84626.1} KW=Complete proteome; Reference proteome OX=5949 OS=Stylonychia lemnae (Ciliate). GN=STYLEM_13691 OC=Stylonychia.
Sequence
MSKNIQEPLLSDSGLQLYQSFKSQEEKPEQLINLKSFATLLNGIEDLGSEIPLEGSEFQK
KKNEIANTKKIEKLYNLPDGIFSFYCPSKRFAYVIVNSKEMYRINISDSTTKRLKDPKVN
QTIDAATATNDSLYIGDDNGQIFKLKDGDDFWTKFQKETDATTKYLAVTPDNKYIIGIFW
DHTLLQYDRDDILLKKICLFMIGSCLNFSSDSKLLIITSNYNSYITLMDVETLEELHTIH
LPDGKMVLSVFITEDNSAIQYQYLREKELYEYKIKPKPLIKILTERKRCGYMIKFSRDFK
YLLYAFWDGTVNVIDFQTNKEVLTLDKGGCPNVDMTKNNQYLISTSSTSNVLIVHSIDIK
TFKITLKYSWQYKNGLKAPSRFWLLEQNEKLVVFYDIYRNYLAFLNWETGEQESYDQGSP
VKWVHQNKLGTFLFLYLQNRKVVKFDPISRQAVKSIQTIIQWPNSLVSFDNDSKIVIAGC
GLQVWDFENEKLIKALDESTTRHVSITLSQSENELYSGGIDKQVKIWDLKNKLLLQAIPM
SSGRFTVELSKNEEYIITTGWENFMWSIKNPLYYPIIEIQNSDNKVQNSQVQAIVSQNFK
IVDLQQSILSHLEVALFQSLKLKEANIDVALKWLSYQNQTIYPFKFTALHILVANGNYDC
IQKALQLGFPYMADDKGKTPLTYAFEQMNLKCVDEIAKYYNESTQDFLITKIDFEQMLQC
NLPSVKALFDKIFTPITRTIEGILPEFGTFSENIYIFQDSKDIDLKKISECAGDVDGDSV
EPVQYLISQFPINFTPGSQESINILKKLVEADPEIFRTSIQMFIDYKWDQFTTSLKIQAF
IYYLYLFIIWINVIYSRNLPIIIVVQISTFLMIMMEGFQFYASKSYYVQDFWNFFDLSGF
LIIFSLTFLQEFEYTFEYFQQLQALGISIIFLRGISYLRAFDSTRYLVGMVIEIIKGMKS
FFILLIYSMLALALIQITLSHEESQSASDYLDNIILYYRLSMGEWEFDSFSEAWILIVFI
FSTLLFPLILMNLLIALMGDTYSRVQDGIIPYDYALKAQLLWELESLMLWKRNQGSSKYM
IVYRKKDIEDNASNIQEGQLRQIKSLCLHIAAKVHKQGTKQ
Download sequence
Identical sequences A0A078ARM0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]