SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A078B3B1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A078B3B1
Domain Number 1 Region: 56-160
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 0.0000589
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A078B3B1
Sequence length 204
Comment (tr|A0A078B3B1|A0A078B3B1_STYLE) Uncharacterized protein {ECO:0000313|EMBL:CDW88924.1} KW=Complete proteome; Reference proteome OX=5949 OS=Stylonychia lemnae (Ciliate). GN=STYLEM_18049 OC=Stylonychia.
Sequence
MSLIQCSYLKSAIILKQDEDISGSRILTLGVIKVNDTMQTIKDIAQKKSHFAITNVTEII
VNTDKKVTQVNVLKFQLNYTGALLTVSENQCVYVIRRGKEEITIERADKLKEGDFLIVQL
HATSAEVLVTRINKIEKLKVNANDLVTVKTTTGNFIADFMAVSDKTDVCPQDKIKPFLLQ
ERKQSKIQIFIEKLKSAVFKISNQ
Download sequence
Identical sequences A0A078B3B1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]