SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A078B8G3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A078B8G3
Domain Number 1 Region: 3-43
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000837
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A078B8G3
Sequence length 203
Comment (tr|A0A078B8G3|A0A078B8G3_STYLE) Uncharacterized protein {ECO:0000313|EMBL:CDW89582.1} KW=Complete proteome; Reference proteome OX=5949 OS=Stylonychia lemnae (Ciliate). GN=STYLEM_18715 OC=Stylonychia.
Sequence
MQSQIQHYLSQIGIDKLLIDAFKEVAFQKPSDPLVFIGEYLQERANIPQSQKIMKTDAII
PQEFQQNSISISKDKIKKDNIFIELDKNTDMSTDFKSSYRNALYIQESERPFIEQEDISI
TLEQRGGRSYQQTKNELEQKIVVGQDSAEDDDDDYFDEINQTPRPHAGVLMDFVRYETNT
HLNDSITTELSADQNPNKYTTNE
Download sequence
Identical sequences A0A078B8G3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]