SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A078BGQ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A078BGQ2
Domain Number 1 Region: 13-124
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 6.02e-38
Family N-utilization substance G protein NusG, N-terminal domain 0.0000938
Further Details:      
 
Domain Number 2 Region: 131-186
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 2.01e-19
Family N-utilization substance G protein NusG, C-terminal domain 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A078BGQ2
Sequence length 187
Comment (tr|A0A078BGQ2|A0A078BGQ2_9BURK) Transcription termination/antitermination protein NusG {ECO:0000256|HAMAP-Rule:MF_00948, ECO:0000256|RuleBase:RU000538, ECO:0000256|SAAS:SAAS00126873} OX=554131 OS=Thiomonas sp. CB2. GN=THICB2_360003 OC=Thiomonas.
Sequence
MAEAQTMAAQAGKQWYVVHAYSGMEKAVQRNLAERIERAGMQTKFGRILVPTEEVVEIKN
GHKSITERRFFPGYVLVEMEMDDATWHLVKHTSKVTGFVGGAKNRPVPISEADVNKIMSQ
MQEGADKPRPKVQFEVGEMVRIKEGPFTDFNGNVEEVNYEKSRLRVSVTIFGRATPVELE
FQQIERL
Download sequence
Identical sequences A0A078BGQ2 A0A160SLS9 A0A1D2UMT8 A0A259Q0S1 A0A259R9E9 D5X010
gi|296137526|ref|YP_003644768.1| WP_013124519.1.17751 WP_013124519.1.2408 WP_013124519.1.37844 WP_013124519.1.68284 WP_013124519.1.92352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]