SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A078BPH3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A078BPH3
Domain Number 1 Region: 47-157
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.01e-29
Family Regulator of G-protein signaling, RGS 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A078BPH3
Sequence length 734
Comment (tr|A0A078BPH3|A0A078BPH3_CAEEL) Regulator of G-protein signaling rgs-6 {ECO:0000313|EMBL:CDX47458.1} KW=Complete proteome; Reference proteome OX=6239 OS=Caenorhabditis elegans. GN=C41G11.3 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MSTPCSGNEPATPTNTSPNNETSNSCLSMGVGVASNETNSSRELKIFKKVIRDPVLRAPF
QEFLEQQFCAENLNFYLAVEQFKEIQDFQERSSFGRRIFDRYFAMNSTEPVNIDNSTSKR
IRETVESGGFPLDTYDVAQYQILHLLKYDCWPRFLRSTNNSQPSFTDEELAADDEDKNGH
SQPTSLNNTNEFEAAAQQSQPAPNAPAATKEKPSKQYSMPAEMTSPVKKNSLSPTHLRRC
RPVEPKHCQLMIGDQFNTETVTLSDPTMSVRRWTQEMADAQGMDRMHVEVVDAETGSTID
PARQAIDALQSRALRLVPVVSFIIEFLPANFSFKNPASTPTKLVCIRARHSLSTGAVLRP
LLHKYTLDPQVTRIVLNGSLEQVKRSCAVGQVSQKCLTVMSEAQYSDRVNAGKVSLPPRD
PILSQLPSTIYEQNNFPFHQNGDISYCEIPNESERNKHAHLQHDGPNAAHQQKEYTLSIF
NKFVRKASHAVSKSDPNPSAGTSQDRMASGVYSPATGGPSFASRAAAGTNFGGSANQVNA
GSASTSSNNVSEPSKNRLSIFKSKTEKKVVKPESEKEKLKPRSDDIPTTSTSTPMAVETK
PNGSRTTEEPLKRMGKSGDDGSQEPQGIRHPAIFSTKIGDEAAAAAAGASPSTSAPSTST
SVQTKTTTSPTKSPTSTTITTSGTTTSATSSVATAPPPVLHAMRSASTPATSSQLTGGGG
GNPRESSWQTAAYV
Download sequence
Identical sequences A0A078BPH3
NP_001294820.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]