SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A078FAN9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A078FAN9
Domain Number 1 Region: 2-66
Classification Level Classification E-value
Superfamily SET domain 0.000000000000867
Family Histone lysine methyltransferases 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A078FAN9
Sequence length 278
Comment (tr|A0A078FAN9|A0A078FAN9_BRANA) BnaC08g43790D protein {ECO:0000313|EMBL:CDY10072.1} KW=Complete proteome; Reference proteome OX=3708 OS=Brassica napus (Rape). GN=GSBRNA2T00031869001 OC=Brassica.
Sequence
MSDVHGWGAFTRHPLKQNELFGEYTGELVSIDEAEEHERADDKLGYSYLFNLNEKPLLSD
TIIEANFSPAFSGAGEAQTRRRRDSSTHFCYIFVSLFFFDLVLVFSPFLSLLSSEFQRFG
SMGSRRRSCCLKSSISASLSLWIIFLSTLNSQAVTVTAPHCVPGSSPDEPLSRDSYLSIL
MWTESVSSLWRSVAQSWSLNALEDLPVAAPLLSIGSNSWISLRPDLKILWHLPCFLSFWM
MITLPTGKICSLSLLDEPVNGLQVMVLSPLSAPPPPVR
Download sequence
Identical sequences A0A078FAN9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]