SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A078FPF9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A078FPF9
Domain Number 1 Region: 4-57
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.00000000000366
Family AN1-like Zinc finger 0.0034
Further Details:      
 
Domain Number 2 Region: 93-143
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.00000000654
Family AN1-like Zinc finger 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A078FPF9
Sequence length 253
Comment (tr|A0A078FPF9|A0A078FPF9_BRANA) BnaC04g47860D protein {ECO:0000313|EMBL:CDY14789.1} KW=Complete proteome; Reference proteome OX=3708 OS=Brassica napus (Rape). GN=GSBRNA2T00084656001 OC=Brassica.
Sequence
MGTPEFPDLGKHCSVDICKQIDFLPFTCDRCLQVFCLDHRSYMKHTCPKGDREDVTVIIC
PLCAKGVRLNPNEDPNITWEKHVNTDCDPSNYEKATKKKKCPVPRCKEQLTFSNTIKCRD
CNVDHCLKHRFGPDHTCPGPRKPEPPRFLGFMSGGSSSSSKKEAKTITRPNKPSSSSRWS
NLLSSAEAGITKLGNDISHKLQFSSSSTSGNDGMVEVCPQCGAKFSSVAVLVEHVEKTHE
RNKKQSYGKSHKC
Download sequence
Identical sequences A0A078FPF9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]