SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A078FRV7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A078FRV7
Domain Number 1 Region: 284-423
Classification Level Classification E-value
Superfamily ApaG-like 3.79e-28
Family ApaG-like 0.00047
Further Details:      
 
Domain Number 2 Region: 93-217
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000112
Family SMI1/KNR4-like 0.015
Further Details:      
 
Domain Number 3 Region: 10-71
Classification Level Classification E-value
Superfamily F-box domain 0.000000229
Family F-box domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A078FRV7
Sequence length 423
Comment (tr|A0A078FRV7|A0A078FRV7_BRANA) BnaA08g28460D protein {ECO:0000313|EMBL:CDY15562.1} KW=Complete proteome; Reference proteome OX=3708 OS=Brassica napus (Rape). GN=GSBRNA2T00089739001 OC=Brassica.
Sequence
MGLEEAGDLVLHIILSKIGPENTARVACVSKRLKVSASEDSLWSIFCSLDLNITTPLGPH
GDPSPSFKAAYQSCRESFRMYPWHLVKRVRRCWDNLKLWLSLNFPEAEATLRKGATEEDL
EEFESALKIKLPLPTRLLYRFVDGQEPRLDGSLGLIGGYSVYSHDVNVYLLPLKEVIRET
NETMSDLGVSNGSNFIVVAASATASLKMFFLDCSDGQLYTGTSTRQMLPCVPEINGDQQQ
DAMLRWLEEHGRRLQSGVIKVREEDNVKSISLFPEVPPLCSVAVTNGVQVRASSVFIPEV
SNLRAQPPAYWYAYSIRMSLMPEGCFLNGRHHSSCQLYWRHWIIRADDEVIDKVNGEAVI
GKYPLLQAGEEEFVYESCSNFPTTSGSIEGSFTFIPGSLKDPKGSQFEVKVEEFPLKLPD
YIF
Download sequence
Identical sequences A0A078FRV7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]