SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A078G0J5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A078G0J5
Domain Number 1 Region: 16-173
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 2.09e-45
Family Thiamin pyrophosphokinase, catalytic domain 0.00013
Further Details:      
 
Domain Number 2 Region: 176-255
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, substrate-binding domain 8.37e-26
Family Thiamin pyrophosphokinase, substrate-binding domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A078G0J5
Sequence length 261
Comment (tr|A0A078G0J5|A0A078G0J5_BRANA) Thiamine pyrophosphokinase {ECO:0000256|PIRNR:PIRNR031057} KW=Complete proteome; Reference proteome OX=3708 OS=Brassica napus (Rape). GN=GSBRNA2T00002649001 OC=Brassica.
Sequence
MSEVMIHSSSFLLPSIPADEASAYAIVVLNQNLPRFTPLLWEHAKLRVCADGGANRIYDE
LPLFFPREDALLIRNRYKPDVIKGDMDSIRLDVLHFYQSLGTKVIDESHDQDTTDLDKCI
LFIRDSTLNQETCRLQILATGALGGRFDHEAGNLNVLYRYPDTRIILLSDDCLIQLLPKT
HRHEIRIQPSLQGPHCGLIPIGAPSAKTTTTGLQWDLNDTEMRFGGLISTSNMVKGEKIT
VESDSDLLWTISIKKQDSTRP
Download sequence
Identical sequences A0A078G0J5 A0A0D3C779
XP_013583843.1.26608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]