SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A078GLW8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A078GLW8
Domain Number 1 Region: 86-189
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.57e-34
Family Chaperone J-domain 0.00011
Further Details:      
 
Domain Number 2 Region: 348-434
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 1.03e-22
Family HSP40/DnaJ peptide-binding domain 0.0011
Further Details:      
 
Domain Number 3 Region: 220-300
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 1.7e-17
Family DnaJ/Hsp40 cysteine-rich domain 0.00019
Further Details:      
 
Domain Number 4 Region: 200-255,302-354
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 5.23e-16
Family HSP40/DnaJ peptide-binding domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A078GLW8
Sequence length 454
Comment (tr|A0A078GLW8|A0A078GLW8_BRANA) BnaA04g12800D protein {ECO:0000313|EMBL:CDY25588.1} KW=Complete proteome; Reference proteome OX=3708 OS=Brassica napus (Rape). GN=GSBRNA2T00032853001 OC=Brassica.
Sequence
MASIQFGSTCVAQWSIRPHFALRAYHHPSSRLQSSTRQQNSMRSQINCLGASRSSMFSHG
SLPFLSMAGMSRNMQPRRGSRFTVRADADYYSVLGVSKNATKSEIKSAYRKLARNYHPDV
NKEPGAEEKFKEISNAYEVLSDDEKKSLYDRFGEAGVKGAGGMGGMGDFSNPFDLFESLF
EGMGGMGGGGGMGRGSRSRAVDGQDEYYSLILNFKEAVFGMEKEIEITRLESCGTCEGSG
AKPGTKPTKCTTCGGQGQVVSSARTPLGVFQQVMTCSSCNGTGEISTPCGTCSGDGRVRK
TKRISLKVPAGVDSGSRLRVRGEGNAGKKGGSPGDLFVVIEVIPDPVLKREDTNILYTCK
ISYIDAILGTTLKVPTVDGTVDLKVPAGTQPGTTLVMAKKGVPVLNKSNMRGDQLVRVQV
EIPKRLSKEEKKLIEELADMSKNKTANSSSSSVR
Download sequence
Identical sequences A0A078GLW8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]