SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A078GUJ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A078GUJ3
Domain Number - Region: 61-130
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0231
Family SMI1/KNR4-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A078GUJ3
Sequence length 139
Comment (tr|A0A078GUJ3|A0A078GUJ3_BRANA) BnaA02g10110D protein {ECO:0000313|EMBL:CDY28819.1} KW=Complete proteome; Reference proteome OX=3708 OS=Brassica napus (Rape). GN=GSBRNA2T00041481001 OC=Brassica.
Sequence
MSHPDSTIHLTQVLNPWSSESSPKTITLPPFTDHLVLHAQMVGNVSLSTYLPNQDDDYIV
SFTFFGSKLCYYMPNRDSNWTIVDILFSYEINFGVIYSRKDQIFYLLTTGCSYMAALDLK
KNKKNPKFMRFQFGNCPLM
Download sequence
Identical sequences A0A078GUJ3 M4E1M0
Bra022670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]