SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A078H7R5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A078H7R5
Domain Number 1 Region: 100-167
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000144
Family HLH, helix-loop-helix DNA-binding domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A078H7R5
Sequence length 271
Comment (tr|A0A078H7R5|A0A078H7R5_BRANA) BnaA06g35910D protein {ECO:0000313|EMBL:CDY33482.1} KW=Complete proteome; Reference proteome OX=3708 OS=Brassica napus (Rape). GN=GSBRNA2T00054728001 OC=Brassica.
Sequence
MNLLNSDDALLMINTLLNSSDLWPLAPANLSQLPLAPTAINSSSDLWPYVPANFGQIQYE
ESNISASAVKLEDSAHFNIDAKTTPEKKRGRRPTHGREEPMNHVEAERLRREKLNQRFYA
LRALLPNATKKEKASILEDTVTYINELKLNAENAETEKNAIENQLNELKEKIAGRRNGSS
SVCSGGEKTPEIEVKIDVKVMDRDALIRLESSKNNHPGARLMNAFMDLEVEVNHASISVM
NDLMIQQVTVKMGSRVYKQEQLRDLLLSKIN
Download sequence
Identical sequences A0A078H7R5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]