SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A078HBX5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A078HBX5
Domain Number 1 Region: 49-264
Classification Level Classification E-value
Superfamily Chlorophyll a-b binding protein 6.28e-78
Family Chlorophyll a-b binding protein 0.00000000173
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A078HBX5
Sequence length 267
Comment (tr|A0A078HBX5|A0A078HBX5_BRANA) Chlorophyll a-b binding protein, chloroplastic {ECO:0000256|RuleBase:RU363080} KW=Complete proteome; Reference proteome OX=3708 OS=Brassica napus (Rape). GN=GSBRNA2T00058211001 OC=Brassica.
Sequence
MAASTMALSSPAFAGKAVKLSPAASEVLGSGRVTMRKTVAKPKGPSGSPWYGSERVKYLG
PFSGEPPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPELLA
RNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGD
GPLGEAEDLLYPGGSFDPLGLATDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGP
LENLADHLADPVNNNAWAFATNFVPGK
Download sequence
Identical sequences A0A078HBX5 A0A0D3BIZ0
XP_013628336.1.26608 XP_013656830.1.73403 XP_013656847.1.73403 XP_013671443.1.73403 XP_018451913.1.40639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]