SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A078HW04 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A078HW04
Domain Number 1 Region: 182-291
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.22e-30
Family B3 DNA binding domain 0.00000304
Further Details:      
 
Domain Number 2 Region: 65-122
Classification Level Classification E-value
Superfamily DNA-binding domain 1.77e-17
Family GCC-box binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A078HW04
Sequence length 315
Comment (tr|A0A078HW04|A0A078HW04_BRANA) BnaA02g27630D protein {ECO:0000313|EMBL:CDY40973.1} KW=Complete proteome; Reference proteome OX=3708 OS=Brassica napus (Rape). GN=GSBRNA2T00072242001 OC=Brassica.
Sequence
MEAVSSVDESSTSTVSIHTSAKIIPPPTTAKLSSPASLYRMGSGSSVVLDSENGVEAESR
KLPSSKFKGVVPQPNGRWGAQIYEKHKRVWLGTFNEEEEAARVYDVAAHRFRGPDAVTNF
KPDATFRNGDGEEVEFLNAHSKYEIVDMLRKHTYKEELEQRKRKQTAFANVTVATGFKTA
ECLFEKTVTPSDVGKLNRLVIPKHQAEKHFPLPLTGDVSVRGTLLNFEDVNGKVWRFRYS
YWNSSQSYVLTKGWSRFVKEKRLCAGDLISFKRSNGQDQQLYIGWKSGLEQDTGRVVVRL
FGVDIASIKSRKTMS
Download sequence
Identical sequences A0A078HW04

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]