SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A078HZG0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A078HZG0
Domain Number 1 Region: 57-113
Classification Level Classification E-value
Superfamily PAH2 domain 0.000000000275
Family PAH2 domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A078HZG0
Sequence length 209
Comment (tr|A0A078HZG0|A0A078HZG0_BRANA) BnaC02g19600D protein {ECO:0000313|EMBL:CDY42986.1} KW=Complete proteome; Reference proteome OX=3708 OS=Brassica napus (Rape). GN=GSBRNA2T00075771001 OC=Brassica.
Sequence
MIIKRQSTRDVREYLQIVLNRFPDNCEIYDKITKLLKNLRLARYFLFEKINGVLIAKPEF
RDASEFLNKVKERLQDEHAYKSLLEILRMFKENKKNFTEVHHEKDRIIASHTDSDLKPEH
RDLDHERSSLKESKEDIRHIGTKNDISKKKLTLTADDSPEISNQAREGDKFCGAVDSQGM
SKDFAFVDRVKEKLNNSEYQEFFEIHDYG
Download sequence
Identical sequences A0A078HZG0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]