SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A078I1G8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A078I1G8
Domain Number 1 Region: 63-107
Classification Level Classification E-value
Superfamily Chlorophyll a-b binding protein 0.00000000196
Family Chlorophyll a-b binding protein 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A078I1G8
Sequence length 117
Comment (tr|A0A078I1G8|A0A078I1G8_BRANA) BnaA05g29110D protein {ECO:0000313|EMBL:CDY44695.1} KW=Complete proteome; Reference proteome OX=3708 OS=Brassica napus (Rape). GN=GSBRNA2T00080672001 OC=Brassica.
Sequence
MASSLLTSTPLSSSFLPVPRRLSVQHGHCQSKRTLRFGLKQSSLCVRAAKLPQGVIVPKV
EPKFVPAFLGFTFTAEIWNSRACMIGLIGTFIVELILNKGILQIIGVDVGKGLDLPL
Download sequence
Identical sequences A0A078I1G8 M4ELT9
XP_009146936.1.100322 Bra029759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]