SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A078I4C5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A078I4C5
Domain Number 1 Region: 11-153
Classification Level Classification E-value
Superfamily SNARE-like 4.58e-29
Family Clathrin coat assembly domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A078I4C5
Sequence length 181
Comment (tr|A0A078I4C5|A0A078I4C5_BRANA) BnaC05g43220D protein {ECO:0000313|EMBL:CDY41585.1} KW=Complete proteome; Reference proteome OX=3708 OS=Brassica napus (Rape). GN=GSBRNA2T00073231001 OC=Brassica.
Sequence
MSGTHDSCPLVKNILLLDSEGKRVAVKYYSDDWATNAAKLSFEKYVFSKTSKTNARTEAE
ITLLDSNIIVYKFAQDLHFFVTGGDDENELVLSSVLQGFFDAVALLLRNNVEKMEALENL
DLIFLCLDEMVDQGVVLETDPNVIAGKVAMQSTEASGSLSEQTLTQALATAREHLARSLL
T
Download sequence
Identical sequences A0A078I4C5 A0A0D3CLM1
XP_013583767.1.26608 XP_013583768.1.26608 XP_013583769.1.26608 XP_013583770.1.26608 XP_013750394.1.73403 XP_013750395.1.73403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]